Antibodies
Rabbit polyclonal antibody to N-terminal region of Caspase 3 | |
---|---|
![]() |
![]() |
Formulation | Lyophilized powder |
Purification | Affinity purified |
Host Species | Rabbit |
Unit Size: | 100 µg |
Immunogen | Synthetic peptide |
Sequence: | MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII |
Alternative Names | Apopain, Cysteine protease CPP32 (CPP-32), protein Yama, SREBP cleavage activity 1 (SCA-1) |
Accession Number: | P42574 |
Gene Symbol | CASP3 |
Accession URL: | http://www.uniprot.org/uniprot/P42574 |
Function: Caspase 3 is a heterotetramer of two heterodimers arranged in anti-parallel orientation. Casapse 3 activates caspases 6 and 7 and this sequential activation leads to apoptosis. CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Caspase 3 participates in cleavage of Amyloid beta 4A precursor protein which is implicated with neuronal death Alzheimer's disease. Caspase 3 in turn is processed by caspases 8, 9 and 10. |
|
Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
Working Dilution for Immunofluorescence (ICC): | 2– 15 µg/mL |
Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
Working Dilution for Western Blottin (WB): | 1 µg/mL |
IHC Positive control: | Cells (HeLA, Jurkat) treated with agents that induce apoptosis such as antibiotic AM-2282 or staurosporin (STS). Spleen, kidney and heart. |
Specificity: | Confirmed by WB. |
Reactivity: | Human |
Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|